SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000003352 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000003352
Domain Number 1 Region: 40-304,403-477
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.72e-80
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.00000035
Further Details:      
 
Domain Number 2 Region: 281-399
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 8.37e-42
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00000623
Further Details:      
 
Domain Number 3 Region: 494-655
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 3.53e-41
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000003352   Gene: ENSSTOG00000003740   Transcript: ENSSTOT00000003741
Sequence length 655
Comment pep:known_by_projection scaffold:spetri2:JH393625.1:1149020:1167508:-1 gene:ENSSTOG00000003740 transcript:ENSSTOT00000003741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAPGELSRTRTGWPATLPTWARGVHFTVDGRKRASAKVSESISTQYPVVDHEFDAVVVGA
GGAGLRAAFGLSEAGFNTACLTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVKG
SDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGRIYQRAFGGQSLKFGKGGQAHRC
CCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMESGECRGVIALCIEDGSIHRIRA
KNTVIATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFVQFHPTGIYGAGCLITE
GCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPEKDHVYLQLH
HLPPEQLAMRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVLKHVNGQD
QIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAQSCRPGDKVPPIKPNAG
EESVSNLDRLRFADGSIRTSELRLSMQKSMQSHAAVFRVGSVLQEGCEKISQLYGDLKHL
KTFDRGVVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVRIDEYDYSKP
IEGQQKKPFGEHWRKHTLSYVDVKTGKVTLEYRPVIDKTLNEADCATVPPAIRSY
Download sequence
Identical sequences ENSSTOP00000019691 ENSSTOP00000003352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]