SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000003400 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000003400
Domain Number 1 Region: 194-312
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 0.00000000000000366
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0095
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000003400
Domain Number - Region: 86-130
Classification Level Classification E-value
Superfamily TGS-like 0.000226
Family TGS domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000003400   Gene: ENSSTOG00000003794   Transcript: ENSSTOT00000003794
Sequence length 338
Comment pep:known_by_projection scaffold:spetri2:JH393450.1:2016035:2033249:1 gene:ENSSTOG00000003794 transcript:ENSSTOT00000003794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVMAATVRGLRLWRAASGGRTGWRFIATSPAVQLSPTELTEMRNDLFNKEKKRQLSLTP
RTEKIEVKHVGKTDSGTVFVMNKNISTPYSCAMHLSEWYCRKSILALVDGQPWEMYKPLT
KSCEIKFLTFKDRDPREVNKLYCNICYNMLYCIMRKLYDMSYIHDLIQLMMISINSSLFS
ILILLNKKVIEMIIVMENLRSFTKDAHALIYKDLQFETLDVDAKVALEMFQHNKYKIDFI
EEKASQNPERIVKLHRIGDFIDVSEGPLIPRTSICFQYEVSAVHNLQPTEPNLVRRFQGL
SLPVHLRAHFTIWDKLLERSRKMVTEDQTKPTEESVST
Download sequence
Identical sequences ENSSTOP00000003400 ENSSTOP00000003400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]