SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000003433 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000003433
Domain Number 1 Region: 2-228
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.26e-56
Family FAD/NAD-linked reductases, N-terminal and central domains 0.007
Further Details:      
 
Domain Number 2 Region: 312-485
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000129
Family FAD/NAD-linked reductases, N-terminal and central domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000003433   Gene: ENSSTOG00000003824   Transcript: ENSSTOT00000003830
Sequence length 533
Comment pep:known_by_projection scaffold:spetri2:JH393291.1:15966178:15984395:-1 gene:ENSSTOG00000003824 transcript:ENSSTOT00000003830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMGRRVAIVGAGVSGLAAIRSCLEEGLEPICFERSDDVGGLWKFSERVEEGRASIYPSVF
ANSSKEMMCFPDFPYPEDFPVFMHNRKLQEYITSFAREKGLLKHIQFETLVSSISKRPDF
STTGQWDVETEKNGKKESAVFDAVMICSGHHVYPNLPKDSFPGLELFGGQCFHSREYKDP
GLWKGKRVLVIGLGNSGSDIAIELSRVAEKVVVSSRSGSWVLSRVWDDGYPWDMVFITRF
QTFLKNSLPTAISDWWYMKQMNSKFKHENYGLMPLNGALRKEPVFNDDLPAHILCGRVSI
KPNVKKFTETSAVFEDGTVFEAIDCVIFATGYGYAYPFLDDSIIKSRNNEVTLYKGIFPP
QLEKSTLAVIGLVQSLGAAIPTTDLQARWATRVIKGTCSLPSRNDMMSDIDEKMGKKLKW
FGKSETIQTDYIVYMDELASFIGVKPSIPWLFLTDPRLAVEVFFGPCSPYQFRLVGPGKW
PGARNAILTQWDRTLRPTRTRAVGEMRKPCLPTQLFKFLALPLLLLAVFLAWV
Download sequence
Identical sequences ENSSTOP00000003433 ENSSTOP00000003433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]