SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000003436 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000003436
Domain Number 1 Region: 7-248
Classification Level Classification E-value
Superfamily Caspase-like 7.59e-51
Family Caspase catalytic domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000003436   Gene: ENSSTOG00000003832   Transcript: ENSSTOT00000003833
Sequence length 250
Comment pep:known_by_projection scaffold:spetri2:JH393504.1:1047912:1051247:-1 gene:ENSSTOG00000003832 transcript:ENSSTOT00000003833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALLLAVIQDRPGAQHDVKALGDLCRALGFKITLRMDPTAQGFQAELAQFRERLDTCRGPV
SCALVALMAHGGPQGQLLGADGQEVQPEALVQELSHCRALRGRPKIFLLQSCRGGNRDAG
VGPVALPWYWRWLRTPLAIPTQADVLQIHTDAQGSPSRDPIPGSSDQADILTVYAATEGC
VAYRDEKGSDLIQTLVEVLRANPRGDLLELLTEVNRRVCELDVLGPDCNELRKACLEIRS
SLRRRLCLQA
Download sequence
Identical sequences I3M333
ENSSTOP00000003436 ENSSTOP00000003436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]