SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000003450 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000003450
Domain Number 1 Region: 3-228
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.1e-58
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0036
Further Details:      
 
Domain Number 2 Region: 304-491
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.04e-17
Family FAD/NAD-linked reductases, N-terminal and central domains 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000003450   Gene: ENSSTOG00000003848   Transcript: ENSSTOT00000003847
Sequence length 539
Comment pep:known_by_projection scaffold:spetri2:JH393291.1:15927424:15944419:-1 gene:ENSSTOG00000003848 transcript:ENSSTOT00000003847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRVAIVGAGVSGLAAIRCCLEEGLEPTCFERSDDIGGLWKFSEHAEEGRASIYRSVFT
NSSKEMMCFPDFPYPDDYPNYMHHSKLQEYLRAFAHAKSLLGHIRFETLVTSVKKCPGFL
VTGQWTVVTEKDGKQESTVFDAVMICSGHHVYPNLPTDSFPGLEQLQGNYLHSRDYKGPE
AFKGKRVLVIGLGNSGSDIAVELSRLAAQVIISTRSGSWVMSRVWDDGYPWDMVYVTRFA
SFLLNILPSFVSDWLYVKKMNTWFKHENYGLVPLNRPLRKEPVFNDELPSRILCGTVSIK
PGVKKFTETSAVFEDGTVFEAIDCVIFATGYGYAYPFLDDSIIKSRNNEVTLYKGIFPPQ
LEKSTLAVIGLVQSLGAAIPTADLQARWAAKVLANSCTLPTTNEMMDDIDEKMGKKLKCM
FFSLLRFGQSCTLQTDYITYMDELASFIGAKPDIAWLFLTDPRLALEVFFGPCSPYQFRL
MGPGKWEGARNAILTQWNRTLRPTRTRAVSEAQQPHHFYNLLKMLSFPLLLLAVWLTFY
Download sequence
Identical sequences ENSSTOP00000003450 ENSSTOP00000003450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]