SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000003703 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSTOP00000003703
Domain Number - Region: 171-242
Classification Level Classification E-value
Superfamily TIMP-like 0.0494
Family Tissue inhibitor of metalloproteinases, TIMP 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000003703   Gene: ENSSTOG00000004132   Transcript: ENSSTOT00000004126
Sequence length 292
Comment pep:known_by_projection scaffold:spetri2:JH393311.1:144736:301199:-1 gene:ENSSTOG00000004132 transcript:ENSSTOT00000004126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMPPPALFCALCCGLLAVSARAGYSEDRCSWRGSGLTQEPGSVGQLTLACVEGAIEWLYP
AGALRLTLGAPDFGTRPGITCLRPARPFAGAQVFAEREGGSLELLLTEGPGLAGGRCVHW
GPRERRALFLQATPHRDISRRVAAFRFELREDRSPELPPQVHGLGEDGACRPCSDEELLL
AACTSDFVIRGTIHRVTHDMELQESVITVVATHILRQTLPLLGMGGPAGQGQAFIRTQLR
CGVRPGPGTFLFMGWSRFGEAWLGCAPRVQEFTRAYTSAQAAHLHPCEVTLD
Download sequence
Identical sequences ENSSTOP00000003703 ENSSTOP00000003703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]