SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000004026 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000004026
Domain Number 1 Region: 60-129
Classification Level Classification E-value
Superfamily Ribosomal protein S18 3.4e-19
Family Ribosomal protein S18 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000004026   Gene: ENSSTOG00000004490   Transcript: ENSSTOT00000004486
Sequence length 260
Comment pep:known_by_projection scaffold:spetri2:JH393286.1:16334766:16351363:1 gene:ENSSTOG00000004490 transcript:ENSSTOT00000004486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASFMALVSGCGRLLRGLLTVPVTTSCPRVPARGFREVVEIQEGKTTIIEGRIIETPKES
PNPPNPSGQCPICRWNLKHKYTYEDVLLLSQFIRPHGGMLPRKITGLCQEEHRKIEECVK
MAHRAGRRPLSEGCRLPPSLSVALRIYPPGKEAGTESGSYTHPVPTSHLVFLDASSATET
IPYMLFLHSGLLPNHRPRLPEGFVPKSKPQPNRYLTRWSPHSVKPIYKKGARWNKVGMAV
GSPLLKDNICYSRTPLKFYH
Download sequence
Identical sequences ENSSTOP00000004026 ENSSTOP00000004026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]