SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000004068 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000004068
Domain Number 1 Region: 437-650
Classification Level Classification E-value
Superfamily TPR-like 3.68e-31
Family Tetratricopeptide repeat (TPR) 0.002
Further Details:      
 
Domain Number 2 Region: 666-806
Classification Level Classification E-value
Superfamily TPR-like 2.6e-22
Family Tetratricopeptide repeat (TPR) 0.0077
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000004068
Domain Number - Region: 184-252
Classification Level Classification E-value
Superfamily SIS domain 0.0222
Family mono-SIS domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000004068   Gene: ENSSTOG00000004530   Transcript: ENSSTOT00000004534
Sequence length 854
Comment pep:known_by_projection scaffold:spetri2:JH393317.1:5310666:5348989:1 gene:ENSSTOG00000004530 transcript:ENSSTOT00000004534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLVEKMADINLKEVTLIVGVVTACYWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQND
FWGTPMSEERSHKSYRPLTVLTFRLNYLFSELKPMSYHLLNMIFHAVVSVIFLKVCKLFL
DNRSSMIAALLFAVHPIHTEAVTGVVGRAELLSSIFFLAAFLSYTKSKGPDNTIAWTPIA
LTVFLVAVATLCKEQGITVVGICCVYEVFIAQGYTLPLLCSTAGQFLRGKGSIPFSMLQT
LIKLIVLMFSTLLLVVIRVQVIQSQLPVFTRFDNPAAVSPTPTRQLTFNYLLPVNAWLLL
NPSELCCDWTMGTIPLIESFLDIRNLATFAFFCFLGALGIFSLRYPGDSSKTVLMALCLM
ALPFIPASNLFFPVGFVVAERVLYVPSMGFCILVAHGWQKILNKSVFKKLSWVCLSMVLL
THALKTLHRNWDWESEYTLFMSALKVNKNNAKLWNNVGHALENEKNFERALKYFLQATHV
QPDDIGAHMNVGRTYKNLNRTREAEESYMMAKSLMPQIIPGKKYAARIAPNHLNVYINLA
NLIRANESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRN
NADLWYNLAIVYIELKEPNEALRNFNHALELNPKHKLALFNSAILMQESGEVKLRPEARK
RLLNYVNEEPQDANGYFNLGMLAMDDKKDTEAEIWMKKAIKLQADFRSALFNLALLYSQT
AKELKALPILEELLRYYPDHIKGLILKGDILMNQKKDILGAKKCFEKILEMDPSNVQGKH
NLCVVYFEEKDLLKAEKCLVETLALAPHEEYIQRHLSIVRDKISSSGFVEQPVFPADKTS
GEEGDKLPAENIKE
Download sequence
Identical sequences ENSSTOP00000004068 ENSSTOP00000004068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]