SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000004190 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000004190
Domain Number 1 Region: 1761-2007
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.99e-52
Family Ankyrin repeat 0.0000000534
Further Details:      
 
Domain Number 2 Region: 392-523
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000251
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 860-902
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000947
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 4 Region: 543-674
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000337
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 5 Region: 731-864
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000989
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 897-941
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000201
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 7 Region: 240-410
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000502
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 8 Region: 1048-1168
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000518
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 9 Region: 962-1102
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000011
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 10 Region: 706-742
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000151
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 11 Region: 209-252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000141
Family EGF-type module 0.02
Further Details:      
 
Domain Number 12 Region: 95-136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000185
Family EGF-type module 0.016
Further Details:      
 
Domain Number 13 Region: 14-54
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family EGF-type module 0.015
Further Details:      
 
Domain Number 14 Region: 131-168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000114
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 15 Region: 171-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000602
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 16 Region: 665-708
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000982
Family EGF-type module 0.02
Further Details:      
 
Domain Number 17 Region: 1246-1285
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000001
Family EGF-type module 0.016
Further Details:      
 
Domain Number 18 Region: 1365-1397
Classification Level Classification E-value
Superfamily Notch domain 0.000000115
Family Notch domain 0.0015
Further Details:      
 
Domain Number 19 Region: 57-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000129
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 20 Region: 1318-1357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000139
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 21 Region: 1444-1475
Classification Level Classification E-value
Superfamily Notch domain 0.000000314
Family Notch domain 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000004190
Domain Number - Region: 1407-1438
Classification Level Classification E-value
Superfamily Notch domain 0.00131
Family Notch domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000004190   Gene: ENSSTOG00000004634   Transcript: ENSSTOT00000004669
Sequence length 2412
Comment pep:known_by_projection scaffold:spetri2:JH393682.1:454392:536324:1 gene:ENSSTOG00000004634 transcript:ENSSTOT00000004669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCPEGFLGEYCQHRNPCEKNRCQNGGTCVAQAMLGKATCRCAPGFTGEDCQYSTSHPCFV
SRPCLNGGTCHMLSRDTYECTCQVGFTGKLCQWTDACLSHPCANGSTCTTVANQFSCKCL
TGFTGQKCETDVNECDIPGRCQHGGTCLNLPGSYQCQCPQGFTGQHCDSPYVPCAPSPCV
NGGTCRQTGDFTFECNCLPGFEGSTCERNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWT
GQFCTEDVDECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGS
TCIDRVASFACMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGAD
CTEDVDECAMANSNPCEHAGRCVNTDGSFHCECLKGYGGPRCEMDINECHSDPCQNDATC
LDKIGGFTCLCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQI
DIDDCSSTPCLNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSY
TCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGINCEINFDDCAS
NPCVHGACMDGINRYSCVCLPGFTGQRCNIDIDECASNPCRKGATCINDVNGFRCMCPEG
PHHPSCYSQVNECLSSPCIHGNCTGGLSGYKCLCDAGWIGTNCEVDKNECLSNPCQNGGT
CDNLVNGYKCTCKKGFKGHNCQVNIDECASNPCLNQGTCFDDVSGYTCHCVLPYTGKNCQ
TVLAPCSPNPCENAAVCKEAPNFESYTCLCAPGWQGQRCTIDIDECVSKPCMNHGLCHNT
QGSYMCECPPGFSGMDCEEDIDDCLANPCQNGGSCVDGVNTFSCLCLPGFTGDKCQTDMN
ECLSEPCKNGGTCSDYVNSYTCKCQAGFDGVHCENNIDECTESSCFNGGTCVDGINSFSC
LCPVGFTGPFCLHEINECNSHPCLNEGTCIDGLGTYRCTCPLGYTGKNCQTLVNLCSHSP
CKNKGTCVQEKAESRCLCPSGWTGAYCDVPNVSCKLAAAHKAVPVERLCQHSGICIDAGN
THHCQCPLGYTGSYCEKQLDECASNPCQHGATCIDFLGGYRCECIPGYQGVNCEYEVDEC
QNQPCQNGGTCIDLVNHFKCSCPPGTRGMKSALLIFHTWPFSKLQIHSYEGIMLRSIKCL
AFSYPWKLRTELSYLFLSLGVLFSNLTYYFCLLKLCYCCRHCETFMDVCPQMPCLNGGTC
AVASNVPDGFICRCPPGFSGARCQSSCGQVKCRKGEQCVHTASGPRCFCPNPQDCESGCA
SSPCQHGGSCYPQRQPPYYSCHCSPPFWGSHCELYTAPTSTPPATCLSQYCTDKARDGVC
DEACNSHACQWDGGDCSLTMENPWANCSSPLPCWDYINNQCDELCNTAECLFDNFECQGN
SKTCKYDKYCADHFKDNHCDQGCNSEECGWDGLDCAADRPENLAEGTLVIVVLMPPEQLL
QDARSFLRALGTLLHTNLRIKRDSQGALMVYPYYGEKSAAMKKQKITRRSLPDEQEQEVA
GSQVFLEIDNRQCVQDSDQCFKNTDAAAALLASHAIQGTLSYPLVSVVSESQLPRRTQLL
YLIAVAVVIILFIMLLGVIMAKRKRKHGSLWLPEGFTLRRDSSNHKRREPVGQDAVGLKN
LSVQVSEANLIGSGTSEHWMDDEGPQPKKAKAEDEALLSEDDDPIDRRPWTQQHLEAADI
RRTPSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDLSDEDEDAEDSSANII
TDLVCQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVA
ADAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKS
ALHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDIT
DHMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVICGPNRSFLSLKHTPM
GKKPRRPNAKSTMPTSLPNLAKEAKEAKGSRRKKSLSEKVQLSESSVTLSPVDSLESPHT
YVSDTTSSPMITSPGILQASPNPMLATAAPAAPVHAQHALSFSNLHDMQPLAPGASTVLP
SVSQLLSHHHIVPPGSGSAGSLGRLHPVSVPSDWMNRVEMNETQYNEMFGMVLAPAEGTH
PGVAPQGRPPEGKHITTPREPLPPIVTFQLIPKGSIAQPAGAPPPQSSCPPAVAGSLPTM
YQIPEMARLPSVAFPTAMMPQQDGQVAQTILPAYHPFPASVGKYPTPPSQHSYASSNAAE
RTPSHGGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGSAGGVQRGPGTHM
SEPPHSNMQVYA
Download sequence
Identical sequences ENSSTOP00000004190 ENSSTOP00000004190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]