SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000004325 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000004325
Domain Number 1 Region: 561-916
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 8.25e-111
Family PDEase 0.00000222
Further Details:      
 
Domain Number 2 Region: 373-556
Classification Level Classification E-value
Superfamily GAF domain-like 3.05e-49
Family GAF domain 0.0000000626
Further Details:      
 
Domain Number 3 Region: 204-387
Classification Level Classification E-value
Superfamily GAF domain-like 5.67e-36
Family GAF domain 0.0000000121
Further Details:      
 
Domain Number 4 Region: 22-176
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000124
Family GAF domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000004325   Gene: ENSSTOG00000004792   Transcript: ENSSTOT00000004814
Sequence length 921
Comment pep:known_by_projection scaffold:spetri2:JH393308.1:1856198:1915434:-1 gene:ENSSTOG00000004792 transcript:ENSSTOT00000004814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRQPAASQDPLAQEPEPPGSRDDRLEDALLSLGSVIDVAGLRRAAKEALSAVLPKVETV
YTYLLDGESRLVCEDPPHELPQEGKVREAVISRKRLSCNGLGPSDLPGKPLARLVAPLAA
DTQVLVIPLVDKEAGAVAAVFLVHCGQLSDSEEWNLQAVEKHTLVALRRVQALQQRGLSA
APAAVQNPPAVAAEDPKGGIEYTDHDRKILQLCGELYDLDATSLQLKVLQYLQQETQASR
CCLLLVSEDNLQLSCKVIGDKVLGEEISFPLTMGRLGQVVEHKKSIQLKDLTSEDVQQLQ
SMLGCELQAMLCVPVISRATDQVVALACAFNKLGGDLFTDQDEHVIQHCFHYTGTVLTST
LAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQNEL
VAKVFDGGVVDDETYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTR
NILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEA
QYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFANFTYTPRSLPEDDTSMAIL
SMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNY
LEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNT
HGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRTNKQHHRLLL
CLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQI
SFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEY
EVPEVDGTRAPVNGCCSLDAE
Download sequence
Identical sequences I3M4X7
XP_005323221.1.77405 ENSSTOP00000004325 ENSSTOP00000004325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]