SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000004530 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000004530
Domain Number 1 Region: 281-438
Classification Level Classification E-value
Superfamily SIS domain 0.000000000017
Family mono-SIS domain 0.0092
Further Details:      
 
Domain Number 2 Region: 29-278
Classification Level Classification E-value
Superfamily SIS domain 0.000000133
Family mono-SIS domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000004530   Gene: ENSSTOG00000005043   Transcript: ENSSTOT00000005050
Sequence length 576
Comment pep:known_by_projection scaffold:spetri2:JH393303.1:5080559:5101892:-1 gene:ENSSTOG00000005043 transcript:ENSSTOT00000005050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGTKRFQHVIETPEPGEWELSGYEAAVPITEKSNPLTRDLDKADVEKIVRLLGQCDAEI
FQEEGQAMPTYQRLYSESVLTTMVQVAEKVQDVLKEPEEALVVLSGGGTSGRMAFLMSVS
FNQLMKGLGQKPLYTYLIAGGDRSVVASRERTEDSALHGIEELKKVTAGKKRVIVIGISV
GLSAPFVAGQMDYCMDNTDVFLPVLVGFNPVSMARNDPIEDWSSTFRQVAERMQKMQEKQ
EAFVLNPAVGPEGLSGSSRMKGGSATKILLETLLLAAHETVDCGIAASQRCLLEILRTFE
RAHQVTYSQNSKIATLMKQVSTSLEKKGRVHLVGWQTLGIIAIMDGVECIHTFGADFRDV
RGFLMGDHSDMFNQKAELTNQGPQFSFSQEDFLTSILPSITEIDTVLFIFTLDDNLMEVQ
TLVEQVKEKTINIQALAHSTVGQSLPTPLKKLFPSIISITWPLLFFEYEGNFIQKFQREL
STKWILNTRFSGQSNARCIESLLQLIHFPQPLSDEIRVAPISCHIQVAQEKEQVIPVALL
SLLFRCSIPEAQAHLAAALSVCEAVRSALAGPGRKR
Download sequence
Identical sequences ENSSTOP00000004530 ENSSTOP00000004530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]