SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000004571 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000004571
Domain Number 1 Region: 43-189
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.57e-24
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0054
Further Details:      
 
Domain Number 2 Region: 156-297
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.61e-21
Family FAD/NAD-linked reductases, N-terminal and central domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000004571   Gene: ENSSTOG00000005093   Transcript: ENSSTOT00000005093
Sequence length 450
Comment pep:novel scaffold:spetri2:JH393281.1:8270711:8296210:1 gene:ENSSTOG00000005093 transcript:ENSSTOT00000005093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLVTVVSSPRARLFACFLRLGTQQTGSLQLHTGASCASKNHYEVLVLGGGSGGITMAA
RMKRKVGAENVAIVEPSERHFYQPIWTLVGAGAKQLSFSGRPTASVIPSGVEWIKARVVE
LNPDKNCVHTDNGKEIFYKYLIIALGIQLDYEKIKGLPEGFAHPKIGSNYSVKTVEKTWK
ALQDFKEGNAIFTFPNTPVKCAGAPQKIMYLSEAYFRKTGKRSKANIIFNTALGTIFGVK
KYADALQEIIQERNLTVNYKQNLIEVRADKQEAVFENLDKPGETQVFSYEMLHVTPPMSS
PDVLKTSPVADAAGWVDVDKETLQHKKYMNVFGIGDCTNLPTSKTAAAVAAQSGILDRTI
SLIMKNQIPKKKYDGYTSCPLVTGYNRVILAEFDYKAQPLETFPFDQSKERLSMYLMKAD
LMPFLYWNVMLRGYWGGPAFLRKLFHLGMS
Download sequence
Identical sequences ENSSTOP00000004571 ENSSTOP00000004571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]