SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000004813 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000004813
Domain Number 1 Region: 146-463
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.18e-120
Family Transglutaminase core 0.000000000171
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily E set domains 4.9e-41
Family Transglutaminase N-terminal domain 0.0000136
Further Details:      
 
Domain Number 3 Region: 486-598
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 7.85e-27
Family Transglutaminase, two C-terminal domains 0.00000351
Further Details:      
 
Domain Number 4 Region: 598-696
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.92e-26
Family Transglutaminase, two C-terminal domains 0.000005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000004813   Gene: ENSSTOG00000005367   Transcript: ENSSTOT00000005373
Sequence length 697
Comment pep:known_by_projection scaffold:spetri2:JH393295.1:16259132:16296853:-1 gene:ENSSTOG00000005367 transcript:ENSSTOT00000005373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALRFQGVNWQKSANRDAHHTEKFSSQELIVRRGQPFEIAIAWNRNITPEEHLDFVVST
GPSSSESAKTKATFPISTGSTGGGWKALLKSKEGNVLTVIISSPVSAPIGWYTLNIQVTS
PSSSEGMYTANLGVFVLLFNPWMQGDDVFMSNEAERREFVEEDSGAIFVGSANRINMVGW
NFGQYEEDILKISLTVLDKSLNFRRDAATDVARRNDPKYITRVLSAMINGNDDYGVLLGN
WSGNYSGGRDPRNWNGSVEILKTWETSGFRPVQFGQCWVFAGVLNTVMRCLGIPARVVTN
FNSAHDTDRNLTVDVYYDPMGNPLQKGSDSVWNFHVWNEAWFMRNDLGPIFNGWQVLDAT
PQERSQGVYQCGPASVNAIREGDVDLNFDMPFIFAEVNADRITWIYNSSNGSQKQNGVDT
HSIGQFISTKAVGSYSRMDVTEKYKYPEGSSEERQVQQRAMKKLKPSASITPTSAESEEG
EGSSPSISGRFKVNGVLEVGQEVNLILLLKNQSQDRKTVAVHMTAWTIVYNGTLVHEVWK
DSAIISLESEEEVQHPVKISYGQYEKYLKADNMIRTTAICKLADEDEVVVERDLVLDNPA
LILEVLDQAQVQKPLNVQMIFSNPLNEPVKDCVLMVEGSGLLRGNLKIDVPSLRPKEQSK
VRFEILPTRSGTKQLLADFSCNKFPAIKAMLSIDVAE
Download sequence
Identical sequences I3M5Y8
ENSSTOP00000004813 ENSSTOP00000004813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]