SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000005021 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000005021
Domain Number 1 Region: 2-153
Classification Level Classification E-value
Superfamily Globin-like 8.86e-39
Family Globins 0.000000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000005021   Gene: ENSSTOG00000005623   Transcript: ENSSTOT00000005611
Sequence length 154
Comment pep:known_by_projection scaffold:spetri2:JH393302.1:4891153:4897643:1 gene:ENSSTOG00000005623 transcript:ENSSTOT00000005611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLSDAEWQLVLNIWGKVETDLAGHGQQVLISLFKGHPETLDKFDKFKHLKSEDEMKASE
DLKKHGTTVLTALGGILKKKGQHEAEIKPLAQSHATKHKIPVKYLEFISEAIIEVLKSKH
SGDFNEAAQGAMRKALELFRNDIAAKYKELGFQG
Download sequence
Identical sequences I3M6D6
XP_005322361.1.77405 ENSSTOP00000005021 ENSSTOP00000005021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]