SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000005319 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000005319
Domain Number 1 Region: 1863-2108
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.34e-53
Family Ankyrin repeat 0.000000058
Further Details:      
 
Domain Number 2 Region: 964-1095
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000408
Family Growth factor receptor domain 0.0091
Further Details:      
 
Domain Number 3 Region: 1164-1306
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000104
Family Growth factor receptor domain 0.0089
Further Details:      
 
Domain Number 4 Region: 585-714
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000215
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 5 Region: 402-527
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000377
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 6 Region: 522-564
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000393
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 7 Region: 850-981
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000573
Family Growth factor receptor domain 0.0084
Further Details:      
 
Domain Number 8 Region: 748-790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000058
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 9 Region: 135-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000267
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 10 Region: 785-821
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000339
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 11 Region: 251-297
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000875
Family EGF-type module 0.016
Further Details:      
 
Domain Number 12 Region: 1139-1175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000237
Family EGF-type module 0.01
Further Details:      
 
Domain Number 13 Region: 282-410
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000361
Family Growth factor receptor domain 0.0097
Further Details:      
 
Domain Number 14 Region: 171-211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000429
Family EGF-type module 0.004
Further Details:      
 
Domain Number 15 Region: 706-749
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000268
Family EGF-type module 0.011
Further Details:      
 
Domain Number 16 Region: 98-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000554
Family EGF-type module 0.03
Further Details:      
 
Domain Number 17 Region: 213-255
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000795
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 18 Region: 54-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000877
Family EGF-type module 0.013
Further Details:      
 
Domain Number 19 Region: 1483-1516
Classification Level Classification E-value
Superfamily Notch domain 0.000000116
Family Notch domain 0.0052
Further Details:      
 
Domain Number 20 Region: 1302-1346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000141
Family EGF-type module 0.011
Further Details:      
 
Domain Number 21 Region: 1523-1555
Classification Level Classification E-value
Superfamily Notch domain 0.000000183
Family Notch domain 0.0043
Further Details:      
 
Domain Number 22 Region: 1384-1422
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000082
Family EGF-type module 0.019
Further Details:      
 
Domain Number 23 Region: 1103-1143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000875
Family EGF-type module 0.027
Further Details:      
 
Domain Number 24 Region: 1442-1474
Classification Level Classification E-value
Superfamily Notch domain 0.00000327
Family Notch domain 0.00019
Further Details:      
 
Domain Number 25 Region: 1339-1379
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000276
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000005319
Domain Number - Region: 826-861
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0117
Family EGF-type module 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000005319   Gene: ENSSTOG00000005889   Transcript: ENSSTOT00000005945
Sequence length 2543
Comment pep:known_by_projection scaffold:spetri2:JH393479.1:1306722:1332428:1 gene:ENSSTOG00000005889 transcript:ENSSTOT00000005945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDHLVTPNVLTLRTAPCSRGARCPPPPPLCMVGGSHSKGLRCSGAFVGQRCQDPNPCLSS
PCKNAGTCRVVDRGGAADYACICPLGFSGPLCLTPLDNACLSSPCRNGGTCDLVTLTEYK
CRCPPGWSGKSCQQADPCASNPCANGGQCLPFESSYICGCPPGFHGPTCRQDVNECSQSP
GLCRHGGTCHNEVGSYRCVCRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDTTYECACL
PGFTGQNCEENVDDCPGNGCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPTAC
QNGGTCHNTLGGYNCVCVNGWTGEDCGENIDDCASAACFHGATCHDRVASFYCECPHGRT
GLLCHLSDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALGANPCEHA
GKCLNTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGVY
CEVNMDECASSPCLHGGRCLDKINEFVCECPTGFSGHLCQYDVDECASTPCRNGARCLDG
PNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGSCKDGVATFTCLCQPGYTGHHCETNINE
CHSQPCRHGGTCQDRDNAYFCFCLKGTTGPNCEVNLDDCASSPCDSGTCLDKIDGYECAC
EPGYTGSMCNVNIDECAANPCHNGGTCEDGINGFTCHCPEGYHDPTCLSEVNECNSSPCV
HGVCRDSLNGYKCDCEPGWSGTNCDINTNECESNPCVNGGTCKDMTSGYVCTCREGFSGP
NCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEGVLAPCAPSPCRNSGVCRE
SEDYESFFCVCPVGWQGQTCEIDVNECVKSPCRHGASCQNTNGSYRCLCQAGYTGRNCES
DIDDCRPNPCHNGGSCTDGVNTAFCDCLPGFQGAFCEEDINECASNPCHHGANCTDCVDS
YTCTCPAGFNGIHCENNTPDCTESSCFNGGTCVDGINAFTCLCPPGFTGSYCQHDINECD
SRPCLHGGTCQDSYGTYKCTCPQGYTGLNCQDLVRWCDSSPCKNGGKCWQTNTLYRCECR
SGWTGLYCDVPSVSCEVAAQQRGVKVSHLCQHGGLCVDAGNTHHCRCQAGYTGSYCEDEV
DECSPSPCQNGATCTDYLGGYSCKCMAGYHGANCSEEINECLSHPCQNGGTCIDLTNTYK
CSCPRGTQGVHCEINVDDCSPPLDPASRSPRCFNNGTCVDQVGGYSCTCPPGFVGERCEG
DVNECLSNPCDARGTQNCVQRVNDFHCECRPGHTGRRCESVINGCKGKPCKNGGTCNVAS
NTARGFICKCPAGFEGATCENDARTCGTLRCLHGGTCISGPRSPTCLCLAPFTGPECQFP
ASSPCLSGNPCYNQGSCEPTSESPFYRCLCPPKFNGLLCHILDYSFGGGAGRDIPPPQIE
EACELPECQADAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGHCD
SQCNSAGCLFDGFDCQHAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVP
ERLAAGTLVLVVLLPPQQLRNHSLHFLRELSRVLHTNVVFKRDAQGHQMIFPYYGHEEEL
RKHPIKRAAGWAAPGSLLGQATASLLPGSSRRQRRELDPMDIRGSIVYLEIDNRQCMQSS
SQCFQSATDVAAFLGALASLGSLNIPYKIDAVQSETVEPPPPAQLHLMYVAAAAFVLLFF
VGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASDGALMDES
QNEWGDEGLETKKFRFEEPVVLPDLDDQTDHRQWTQQHLDAADLRMSAMAPTPPQGEVDA
DCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGE
TALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLD
ARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLK
NGANKDMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDI
VRLLDEHNLVRSPQLHGAALGSTPRLSPTLCSPSGYLGNLKPSVQGKKARKPSTKGPACG
SKEARDLKARRKKSQDGKGCLLDSSSMLSPVDSLESPHGYLSDVASPPLLPSPFQQSPSM
PLNHLPGMPDAHLGISHLNVAAKPEMAALGGGSRLAFEPGPPRLSHLPVASSTGTILGAS
STGAVNFTVGGAAGLNGQCEWLSRLQSGMVPSQYNPLRGAVAPGTLSTQAPALQHTMMGS
LPGSLSASALSQMMSYQGLPSARHATQPHLVQPQQVPQQNLQMQQQNLQMPDMQQPQSLQ
PPAQPHLGVGTAASGHLGRSFLGGEPSQDVQPLGPSNLTVHTILPQESQALPTSLPSSLV
PPMTTTQFLTPPSQHSYSSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNISDW
SEGISSPPTTMQSQVTHIPEAFK
Download sequence
Identical sequences ENSSTOP00000005319 ENSSTOP00000005319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]