SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000005370 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000005370
Domain Number 1 Region: 23-201
Classification Level Classification E-value
Superfamily TIMP-like 8.83e-69
Family Tissue inhibitor of metalloproteinases, TIMP 0.0000000514
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000005370   Gene: ENSSTOG00000006013   Transcript: ENSSTOT00000006002
Sequence length 206
Comment pep:known_by_projection scaffold:spetri2:JH393312.1:13347029:13350067:1 gene:ENSSTOG00000006013 transcript:ENSSTOT00000006002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPFVPLASGILLLSLIAPSWACTCAPPHPQTAFCNSDVVIRAKFMGPPEVNQDMAYQRY
EIKMTKMFKGFQALGPAADIRFLYTPAMESVCGYFHNSQNRSEEFLIAGQLQNKLLHITT
CSFVAPWNSLSPAQRKGFTKTYSAGCEACTVLACSSIPCKLEKDTQCLWTDQLLDGSERG
FQSRNLACLPREPGVCTWQSLRVRMA
Download sequence
Identical sequences I3M740
ENSSTOP00000005370 ENSSTOP00000005370 XP_005324081.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]