SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000005580 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000005580
Domain Number 1 Region: 40-166
Classification Level Classification E-value
Superfamily Lysozyme-like 3.49e-47
Family C-type lysozyme 0.0000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000005580   Gene: ENSSTOG00000006249   Transcript: ENSSTOT00000006242
Sequence length 167
Comment pep:novel scaffold:spetri2:JH393531.1:329533:332103:1 gene:ENSSTOG00000006249 transcript:ENSSTOT00000006242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQGESGARHQLQGLAGVIMLAWGTVLVIWATLIIASVDPKIYERCELAKKLQKAGLDGYR
GYQIGDWLCMAHYESGFDTSFVDHNPDGSSEYGIFQLNSAWWCDNGVTPTQNLCHMDCHD
LLNRHILDDILCAKRVVSAPGSMKAWDSWTRHCSGHDLSEWLKGCEI
Download sequence
Identical sequences ENSSTOP00000005580 ENSSTOP00000005580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]