SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000005651 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000005651
Domain Number 1 Region: 14-363
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.83e-110
Family Phosphofructokinase 0.000000243
Further Details:      
 
Domain Number 2 Region: 350-770
Classification Level Classification E-value
Superfamily Phosphofructokinase 9.03e-105
Family Phosphofructokinase 0.00000647
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000005651   Gene: ENSSTOG00000006311   Transcript: ENSSTOT00000006319
Sequence length 792
Comment pep:known_by_projection scaffold:spetri2:JH393294.1:11103981:11161206:-1 gene:ENSSTOG00000006311 transcript:ENSSTOT00000006319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSVPLTPKGSFPRYLEHLSGSGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFI
YEGYQGMVDGGSNIVEAKWESVSSILQVGGTIIGSARCKAFHTREGRLQAAANLVQWGIT
NLCVIGGDGSLTGANIFRKEWSELLVELAKNGKISEEAVTKYSYLNVVGMVGSIDNDFCG
TDMTIGTDSALHRIMEVIDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLP
ESPPEEGWEENMCVKLSENRARKKRLNIIIVAEGAIDTQNQPISSQKIKDLVVKQLGFDT
RVTILGHVQRGGTPSAFDRILASRMGVEAVVALLEATPETPACVVSLSGNQAVRLPLVEC
VQMKTQDVQKAMDERRFKDAVRLRGRSFEGNLNIYKRLAIKLPDDQITKSNCSVAVINVG
APAAGMNAAVRSAVRVGIADGHKMLAIYDGFDGFAKGQIKEIGWSDVGGWTGQGGSILGT
KRVLPGKFLEEIAEQIRAHSINALLIIGGFEAYLGLLELSAAREKYEELCIPMVMVPATV
SNNVPGSDFSIGSDTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAG
ADAAYIFEEPFDIRDLQSNVEHLTEKMKTSIQRGLVLRNESCSENYTTDFIYQLYSEEGK
GVFDCRKNVLGHMQQGGVPSPFDRNFGTKISARAMQWITTKLKESYGKGKKCVSDDYICV
LGISKRNVIFQPVADLKEETDFEHRIPKEQWWLKLRPLMKILAKYKASFDVSDSGQLEPV
QDQNTQGEPAAI
Download sequence
Identical sequences ENSSTOP00000005651 ENSSTOP00000005651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]