SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000005802 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000005802
Domain Number 1 Region: 19-170
Classification Level Classification E-value
Superfamily Globin-like 4.34e-44
Family Globins 0.000000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000005802   Gene: ENSSTOG00000006499   Transcript: ENSSTOT00000006488
Sequence length 190
Comment pep:known_by_projection scaffold:spetri2:JH393404.1:1605900:1613742:-1 gene:ENSSTOG00000006499 transcript:ENSSTOT00000006488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKVPGEMEIERRERSEELSEAERKAVQATWARLYANCEDVGVAILVRFFVNFPSAKQYF
SQFKHMEEPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVE
PVYFKILSGVILEVIAEEFANDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATT
PPTTLPSSGP
Download sequence
Identical sequences I3M805
XP_005332657.1.77405 ENSSTOP00000005802 ENSSTOP00000005802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]