SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000006659 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000006659
Domain Number 1 Region: 39-408
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.89e-61
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000128
Further Details:      
 
Domain Number 2 Region: 385-496
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.29e-42
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000281
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000006659   Gene: ENSSTOG00000007445   Transcript: ENSSTOT00000007454
Sequence length 509
Comment pep:known_by_projection scaffold:spetri2:JH393289.1:16248124:16271481:-1 gene:ENSSTOG00000007445 transcript:ENSSTOT00000007454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSWSRVYCSLAKRGHFNRICHGLQGVSAVPLRTYADQSIDADITVIGSGPGGYVAAIKA
AQLGFKTVCIEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHGKDFASRGIEMSEVRLNL
EKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITGKNQVTATKADGSTQVVDTKNIL
IATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVT
AVEFLGHVGGVGIDMEVSKNFQRILQKQGFKFKLNTKVTGATKKSDGKIDVSIEAASGGK
AEVITCDVLLVCIGRRPFTQNLGLEDLGIELDPRGRIPVNTRFQTKIPNIYAIGDVVAGP
MLAHKAEDEGIICVEGIAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGK
FPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDI
ARVCHAHPTLSEALEKQTWLHHLANQSIF
Download sequence
Identical sequences ENSSTOP00000006659 ENSSTOP00000006659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]