SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000006884 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000006884
Domain Number 1 Region: 523-553,659-736
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000267
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000006884   Gene: ENSSTOG00000007661   Transcript: ENSSTOT00000007697
Sequence length 790
Comment pep:known_by_projection scaffold:spetri2:JH393367.1:6562103:6588200:1 gene:ENSSTOG00000007661 transcript:ENSSTOT00000007697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPRPRYVVDRTAYSLTLFDDEFEKKDRPYPVGEKLRNAFSCSSAKIKAVVFGLLPVLS
WIPKYKIKDYIIPDLLGGLSGGCIQVPQGMAFALLANLPAVNGLYSSFFPLLTYFFLGGV
HQMVPGTFAVISILVGNICLQLAPESKFRVFNNATNESYVDTAAMETERLHVSATLACLT
AIIQMGLGFMQFGFVAIYLSESFIRGFMTAAGLQILISVLKYIFGLTIPSYAGPGSIVFT
FIDICKNLPHTNIASLIFALISGAFLVLVKELNARYMHKIRFPIPSEMIVVVVATAISGS
YKMPRKYHMQIVGEIQSGFPAPVSPVVSQWKDMIGTAFSLAIVGYVINLAMGRTLASKHG
YDVDSNQEMIALGCSNFFGSFFKIHVICCALSVTLAVDGAGGKSQVASLCVSLVVMITML
VLGSYLYPLPKAVLGALIAVNLKTSLKQLTDPYYLWRKSKLDCCVWVVSFLSSFFLSLPY
GVAVGVAFSVLVVVFQTQFRNGYALAQVMDTDIYVNPKTYNRVQEIEGIKIVTYCSPLYF
ANSEIFRQKVVAKTGMDPQKVLLAKQKYLRKQEKRMMPTQHRKSLFMKTKTVSLQELQQD
FENASPTDPNNNQTPANGASISYITFSPDTSSAAPCEPSASAGSPSEPSDTLASVPPFVT
FHTLILDMSGVSFVDLMGIKALGKLSSTYGKIGVKVFLVNIHAQVYKDISHGGVFEDGCL
ERNHIFPSIHDAVLFAQANAREVAPGHSFQGAPGATELSLYDSEEDGPSYWDLEQEMFGS
MFHAETLTAL
Download sequence
Identical sequences I3MA87
ENSSTOP00000006884 ENSSTOP00000006884 XP_005329550.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]