SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000006909 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000006909
Domain Number 1 Region: 3-75
Classification Level Classification E-value
Superfamily RING/U-box 3.28e-19
Family RING finger domain, C3HC4 0.0000112
Further Details:      
 
Domain Number 2 Region: 103-188
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.31e-16
Family Canonical RBD 0.0000113
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000006909
Domain Number - Region: 191-218
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00602
Family CCCH zinc finger 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000006909   Gene: ENSSTOG00000007717   Transcript: ENSSTOT00000007722
Sequence length 270
Comment pep:known_by_projection scaffold:spetri2:JH393402.1:196600:321128:-1 gene:ENSSTOG00000007717 transcript:ENSSTOT00000007722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPY
PEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRL
ADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVV
VDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKL
LQELYKLNPNFLQLSTGSVDKNKNKVTPLQ
Download sequence
Identical sequences U6D938
ENSSTOP00000006909 ENSSTOP00000006909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]