SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000007347 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000007347
Domain Number 1 Region: 69-140
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 2.22e-19
Family F1F0 ATP synthase subunit C 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000007347   Gene: ENSSTOG00000008217   Transcript: ENSSTOT00000008204
Sequence length 141
Comment pep:known_by_projection scaffold:spetri2:JH393322.1:10909064:10917220:-1 gene:ENSSTOG00000008217 transcript:ENSSTOT00000008204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYACSRFLSTHSLVRSTSHLLSRPLSAVVLNRPETLTYESFSSLAVPFPLTSLIPSLRFQ
TSTISRDIDTAAKFIGAGSATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGF
AFSEAMGLFCLMVAFLILFAM
Download sequence
Identical sequences I3MB77
ENSSTOP00000007347 ENSSTOP00000007347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]