SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000007459 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000007459
Domain Number 1 Region: 299-597
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.46e-83
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000208
Further Details:      
 
Domain Number 2 Region: 122-298
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.15e-37
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.00078
Further Details:      
 
Domain Number 3 Region: 599-707
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.31e-24
Family Anticodon-binding domain of Class II aaRS 0.0011
Further Details:      
 
Domain Number 4 Region: 61-122
Classification Level Classification E-value
Superfamily TGS-like 0.00000000000785
Family TGS domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000007459   Gene: ENSSTOG00000008311   Transcript: ENSSTOT00000008321
Sequence length 716
Comment pep:known_by_projection scaffold:spetri2:JH393390.1:731938:749826:1 gene:ENSSTOG00000008311 transcript:ENSSTOT00000008321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWYPGWRRLGLRELPARKLHTASVPAPAPWLVERLGLFEELWAAQVKRLARKAHREPRP
ITVTLPGGQKVEAVAWSTTPYQLARRISLTLADTAVAAQVNGEPYDLERPLETDSDLRFL
TFDSPEGKAVFWHSSTHVLGAAAEQFLGAILCRGPSTQCGFYHDFFLGKERVQFGIEIWV
RASQEIAAAAQPFRRLEASQDQLRQLFKDNPFKLHLIEEKVTGPTATVYGCGMLVDLCQG
PHLRHTGQIGKLKLLTNSSSLWRTSGAPEALQRVSGISFPTAELLRAWEAQKEEAELRDH
RRVGKEQELFFFHELSPGSCFFLPRGTRVYNALVAFIRAEYARRGFSEVKTPTMFSTKLW
EQSGHWEHYREDMFTLKPPGSDRSTSSQRDHSAKHPTNTFALKPMNCPAHCLIFAHRPRS
WRELPIRLADFGALHRAEASGSLGGLTRLWRFQQDDAHIFCAPDQLETEIRSCLDFLRSV
YAVLGFSFRLALSTRPSGFLGEPCLWDQAEQVLQQALEDFGEPWDLNPGDGAFYGPKIDV
HLHDALGRPHQCGTIQLDFQLPLRFNLQYKGQVGALERPVLIHRAVLGSVERLLGVLAES
CGGKWPLWLSPFQVVVIPVGTEQEEYAREIQQNLQAAGLVSDLDADSGVTLSRRVRRAQL
AHYNFQFVVGQQEQSKRTVNIRTRSNRRLGEWDLTKAVQRLLELQNTRVPNAEEIF
Download sequence
Identical sequences ENSSTOP00000007459 ENSSTOP00000007459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]