SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000007463 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000007463
Domain Number 1 Region: 1-298
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5e-25
Family FAD-linked reductases, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000007463   Gene: ENSSTOG00000008327   Transcript: ENSSTOT00000008327
Sequence length 468
Comment pep:known_by_projection scaffold:spetri2:JH393301.1:14423841:14439517:1 gene:ENSSTOG00000008327 transcript:ENSSTOT00000008327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IAIIGAGIGGTSSAYYLRQKFGKDVKIDLFERKEVGGRLATLTVEGQEYEAGGSVIHPLN
LHMKRFVKDLGLSTVQASGGLLGVYDGQTLVFEESSWFIMNMIKLVWRYGFQSLRMHMWV
EDVLDKFMRIYRYQSHDYAFSSVEKLLHAVGGDDFLGLLNRTLHETLQKAGFSEKFLNEM
IAPVMRVNYGQSTDINAFVGAVSLTAADSGLWAVEGGNKLVCSRLLQASKSNLISGSVMY
IEKTRTKQTGNPTKMYEVVYQSGSETHSDFYDIVLVATPLNQKMSNITFLNFDPPIEEFH
QYYQHIVTTLVKGELNSTVFSSRAKDQFGLSTVLTTDSSDLFINNVGIVSSVREKDSPQP
STDGTYVWKTFSPEVLTKQQIFKLFLSYDYAVKKSWLAYPHYKPPEKCPSIILHDRLYYL
NGIEFAASAMEMSAIAAHNAALLAYHRWNGNADMIDQDGLYEKLKTEL
Download sequence
Identical sequences ENSSTOP00000007463 ENSSTOP00000007463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]