SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000007688 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000007688
Domain Number 1 Region: 464-552
Classification Level Classification E-value
Superfamily PH domain-like 7.62e-19
Family Third domain of FERM 0.005
Further Details:      
 
Domain Number 2 Region: 278-371
Classification Level Classification E-value
Superfamily PH domain-like 2.24e-17
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 
Domain Number 3 Region: 168-219
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000641
Family Second domain of FERM 0.011
Further Details:      
 
Domain Number 4 Region: 428-463
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000157
Family Second domain of FERM 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000007688   Gene: ENSSTOG00000008563   Transcript: ENSSTOT00000008577
Sequence length 575
Comment pep:known_by_projection scaffold:spetri2:JH393507.1:1928494:2007367:1 gene:ENSSTOG00000008563 transcript:ENSSTOT00000008577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLDDQSEDEALE
LEGPLITPGSGSIYSSPGLYSKTMTPTYDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQ
PITSPEILAKMFKPQALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSFFDLNPK
YDAIRINQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIMTSENHLNNSDKEVDE
VDAALSDLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSIS
CYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYA
HWMAACRLASKGKTMADSSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDINPECLVSPR
YLKKYKNKQITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEEL
IGIAYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKV
VHEFIGGYIFLSTRAKDQNESLDEEMFYKLTSGWV
Download sequence
Identical sequences ENSSTOP00000007688 ENSSTOP00000007688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]