SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000007806 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000007806
Domain Number 1 Region: 32-131
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.34e-46
Family Ankyrin repeat 0.00000316
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000007806   Gene: ENSSTOG00000008721   Transcript: ENSSTOT00000008710
Sequence length 131
Comment pep:known_by_projection scaffold:spetri2:JH393462.1:3578338:3581115:-1 gene:ENSSTOG00000008721 transcript:ENSSTOT00000008710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGGNSSDAGLANAAARGQLEKVRQLLEAGADPNGVNRFGRRPIQVMMMGSTHVAELLLL
HGAEPNCADPATLTRPVHDAAREGFLDTLVALHRAGARLDVRDAWGRLPVDLAEELGHRE
VAEYLRAAAGD
Download sequence
Identical sequences I3MC53
ENSSTOP00000007806 ENSSTOP00000007806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]