SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000007828 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000007828
Domain Number 1 Region: 489-835
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.5e-112
Family PDEase 0.000000285
Further Details:      
 
Domain Number 2 Region: 56-250
Classification Level Classification E-value
Superfamily GAF domain-like 2.4e-32
Family GAF domain 0.00042
Further Details:      
 
Domain Number 3 Region: 237-289,321-458
Classification Level Classification E-value
Superfamily GAF domain-like 6.17e-30
Family GAF domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000007828   Gene: ENSSTOG00000008725   Transcript: ENSSTOT00000008733
Sequence length 860
Comment pep:known_by_projection scaffold:spetri2:JH393314.1:5018348:5088086:1 gene:ENSSTOG00000008725 transcript:ENSSTOT00000008733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEVTAEEVEKFLDSNIGFAKRYYDLHYRAKVISDLLGAKEAAVDFSYYHPLSSVEESEI
IFDLLRDLQENLQAEKCTFNVMKKLCFLLQADRMSLFMYRARNGIGELATRLFNVHKDAT
FEECLVMPDSEIVFPLDMGVVGYVAQSKKVINVPNTKEDEHFCDFVDNLTEYQTKNILAS
PIMNGKDLVAVLMAVNKVDGPHFTKGDEEILLKYLNFANLLMKVYHLSYLYNCETRRGQI
LLWSGSKVFEELTDIERQFHKALYTVRAFLNCDRYSVGLLDMTKQKEFFDVWPVLMGEVP
PYTGPRTPDGREINFYKVIDYILHGKEDIKVIPNPPPDHWALVSGLPTYVAQNGLICNIM
NAPAEDLFAFQKEPLDDSGWMIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEMDETLM
ESLTQFLGWSVLNPDTYESMNKLENRKDIFQDIVKYHVKCDNEEIQKILKTREVYGKEPW
DCEEEELTEILRGELPDVEKYEINKFHFSDLPLTELELVKCGIQMYYELKVVEKFHIPQE
ALVRFMYSLSKGYRKITYHNWRHGFNVGQTMFSLLVTGKLKRYFTDLEALAMVTAAFCHD
IDHRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKTLLRDESLNIFQNLNRRQHEHAIH
MMDIAIIATDLALYFKKRTMFQKIVDQSKTYENEQEWTQYMMLEQTRKEIVMAMMMTACD
LSAITKPWEVQSKVALLVAAEFWEQGDLERTVLQQSPIPMMDRNKADELPKLQVGFIDFV
CTFVYKEFSRFHEEITPMLDGITNNRKEWKALADEYEAKMKALEEEKQKQQEAQQAASGN
QPTGNPNPGGAPASKSCCIQ
Download sequence
Identical sequences I3MC68
ENSSTOP00000007828 XP_005324229.1.77405 ENSSTOP00000007828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]