SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000007926 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000007926
Domain Number 1 Region: 149-466
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.16e-127
Family Transglutaminase core 0.00000000395
Further Details:      
 
Domain Number 2 Region: 7-148
Classification Level Classification E-value
Superfamily E set domains 1.47e-42
Family Transglutaminase N-terminal domain 0.00012
Further Details:      
 
Domain Number 3 Region: 500-611
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.93e-28
Family Transglutaminase, two C-terminal domains 0.00027
Further Details:      
 
Domain Number 4 Region: 614-709
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.76e-23
Family Transglutaminase, two C-terminal domains 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000007926   Gene: ENSSTOG00000008836   Transcript: ENSSTOT00000008845
Sequence length 710
Comment pep:known_by_projection scaffold:spetri2:JH393295.1:16192912:16212597:-1 gene:ENSSTOG00000008836 transcript:ENSSTOT00000008845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISLRSASAGVRVTSVDWQRSGNGTAHHTQEYPCPELVVRRGQPFRLTLDLSGDLDSEETL
IFTVETGPKASEALHTKAVFQTAELEGGDVWTAVKESQTENSMSVSLASPPDAVIGRYQL
SARASSRRRHSDRKLGEFVLLFNPWCPEDDVFLASEEERQEYVLNDSGIIFRGVEKHIRA
QGWNYGQFEEDILDICLSILDRSPSHQDDPATDVSHRHNPIYVTRIISAMVNSNNDRGVV
QGQWQGKYGSGTSPLHWRGSVAILQKWFKSRFKPVKYGQCWVFAGVMCTVLRCLGIATRV
VSNFNSAHDTDKNLSVDKYVDSFGRTLEDLTEDSMWNFHVWNESWFARQDLGPSYNGWQV
LDATPQEESEGVFQCGPASVTAIREGDIHLAHDGPFVFAEVNADYITWLWNEDESRERVY
SDTKKIGRCISTKAVGSDSRVDITGLYKYPEGSRKERQVYSKAVKKLFGVEARGRRTWIR
RAGGRGLWRDDLLEPATKPSITGKFKVLEPPVLGHDLQLALCLTNLTSRAQRVQVNLSGA
TILYTRRPVAEILHESHAVKLGPQEEKKIPVAISYSQYKEDLTEDKKILLAAMCFVSKGE
KLLVEKDITLEDFITIKVLGPATVGVAVIVEVTVVNPLLEKVEDGVLMVEGSGLLQGQLS
IEVPSLQPQEKALVQFNITPSKSGPRQLQVDFVSHHFPDIKGFVIVDVAT
Download sequence
Identical sequences ENSSTOP00000007926 ENSSTOP00000007926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]