SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000008284 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000008284
Domain Number 1 Region: 358-480
Classification Level Classification E-value
Superfamily TIMP-like 3.14e-21
Family Tissue inhibitor of metalloproteinases, TIMP 0.02
Further Details:      
 
Domain Number 2 Region: 45-96
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000994
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000008284   Gene: ENSSTOG00000009230   Transcript: ENSSTOT00000009235
Sequence length 482
Comment pep:known_by_projection scaffold:spetri2:JH393398.1:811633:875568:-1 gene:ENSSTOG00000009230 transcript:ENSSTOT00000009235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAHPDPALECCIGTLCPLRPRPFQSLLLVLWTLLNCVLGSSAQGPGEWTPWGSWSRCSSS
CGRGVSVRSRRCIRLPGEEPCWESGHEYRVCQLPDCPPGAVPFRDLQCALYNGHPVLGTQ
KTYQWIPFHGAPNQCDLNCLAEGHTFYHSFGRVLDGTPCSPGAQGLCVAGRCLSAGCDGV
LGSGALEDRCGRCGGANDSCLFVQRVFRDAGAFAGYWNVTLIPEGARHIRVAHRSRNHLA
LMGVDGRYVLNGNWEVSPPGTYEAAGTRVVYARAAAPQETLQAAGPTSQDLLLQILLQEP
NPGVQFEFWLPRERYGPFQVQTQALGWPVRQPQPREVEARAPIAPPPLPVPLTAPPPTDP
CPPCPDTRGRAHRLLHYCGSDFVFQARVVGRHRQAQETRYEVHIQLIYKNRWPLRTREYV
WAPAHCPCPPLAPQQEYLMALRRLVSPDGTQDRLLLPHAGYARPWSPAEDSRIRLAARRC
PV
Download sequence
Identical sequences ENSSTOP00000008284 ENSSTOP00000008284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]