SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000008425 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000008425
Domain Number 1 Region: 17-192
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 1.7e-58
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0000000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000008425   Gene: ENSSTOG00000009400   Transcript: ENSSTOT00000009394
Sequence length 194
Comment pep:known_by_projection scaffold:spetri2:JH393281.1:33964323:33982831:1 gene:ENSSTOG00000009400 transcript:ENSSTOT00000009394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRPHMESYPGAASLVERKFHVLVGVTGSVAALKLPFLVSKLLDIPGLEVTVVTTERAKHF
YNPQDIPVTLYSDSDEWEMWKHRSDPVLHIDLRRWADLMLVAPLDANTLGKVASGICDNL
LTCVIRAWDRSKPLLFCPAMNTVMWEHPLTAQQVDQLKAFGYVEIPCVDKKLVCGDQGLG
AMAEVETIVDKVKE
Download sequence
Identical sequences ENSSTOP00000008425 ENSSTOP00000008425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]