SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000008458 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000008458
Domain Number 1 Region: 355-669
Classification Level Classification E-value
Superfamily Folate-binding domain 1.15e-83
Family Aminomethyltransferase folate-binding domain 0.0000592
Further Details:      
 
Domain Number 2 Region: 2-158,263-347
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1e-36
Family FAD-linked reductases, N-terminal domain 0.00074
Further Details:      
 
Domain Number 3 Region: 160-262
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.22e-19
Family L-aminoacid/polyamine oxidase 0.044
Further Details:      
 
Domain Number 4 Region: 672-764
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.000000000000425
Family Aminomethyltransferase beta-barrel domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000008458   Gene: ENSSTOG00000009422   Transcript: ENSSTOT00000009429
Sequence length 785
Comment pep:known_by_projection scaffold:spetri2:JH393285.1:23339393:23368425:1 gene:ENSSTOG00000009422 transcript:ENSSTOT00000009429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADYSNRLYHQLEQETGIQTGYIRTGSIFLAQTQDRLISLKRINSSLNVTGIPSEIISPK
KVAELYPLLNVHDLVGAMHVPEDAVVSSADVALALASAASQNGVQIYDRTTILHIMVKKG
QVTGVETDKGQIECQYFVNCAGQWAYELGLSNEEPVSIPLHACEHFYLLTRPLETPLQSN
TPTIVDADGRIYIRNWQGGILSGGFEKNPKPIFTEGKNQLEIQNLQEDWDHFEPLLSSLL
RRMPELETLEIMKLVNCPETFTPDMRCIMGESPVVQGYFVLAGMNSAGLSFGGGAGKYLA
EWMVHGYPSENVWDLDLKRFGALQSSRTFLRHRVMEVMPLIYDLKVPRWDFQTGRQLRTS
PLYDRLDAQGARWMEKHGFERPKYFVPPDKGKKSNFYLLALEQSKTFYKPDWFDIVEAEV
KCCKEAVCVIDMSSFTKFEITSTGDQALEILQYLFSNDLDVPVGHIVHTGMLNEGGGYEN
DCSIARLSKRSFFMISPTDQQVHCWAWLKKHMPKDNNLLLEDVTWKYTALNLIGPRAVDV
LSELSYAPMTPDHFPTLFCKEMSVGYANGIRVMSMTHTGEPGFMLYIPIEYALHVYNEVM
NVGQKYGIRNAGYYALRSLRIEKFFAFWGQDLNTLTTPLECGRESWVKLEKGMDFIGREA
LLQQKQDGVYKRFTMFILDDHDTDLDLWPWWGEPIFRNGQYVGKTTSSAYSYTLERHVCL
GFVHNFSEDSGEEEVVTTDFINRGEYEIDIAGHRFQAKAKLYPVTSLFAHKRRKDDVELS
DLHGK
Download sequence
Identical sequences ENSSTOP00000008458 ENSSTOP00000008458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]