SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000008467 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000008467
Domain Number 1 Region: 7-104
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000000000645
Family N-acetyl transferase, NAT 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000008467   Gene: ENSSTOG00000009438   Transcript: ENSSTOT00000009439
Sequence length 111
Comment pep:known_by_projection scaffold:spetri2:JH393346.1:1236171:1256977:-1 gene:ENSSTOG00000009438 transcript:ENSSTOT00000009439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVC
CRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYL
Download sequence
Identical sequences XP_006627798.1.81211 ENSSTOP00000008467 ENSSTOP00000008467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]