SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000009026 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000009026
Domain Number 1 Region: 32-113
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000188
Family Growth factor receptor domain 0.0049
Further Details:      
 
Domain Number 2 Region: 101-172
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000157
Family Fibronectin type I module 0.046
Further Details:      
 
Domain Number 3 Region: 205-248
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000288
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000009026   Gene: ENSSTOG00000010067   Transcript: ENSSTOT00000010063
Sequence length 356
Comment pep:known_by_projection scaffold:spetri2:JH393280.1:27179674:27185492:-1 gene:ENSSTOG00000010067 transcript:ENSSTOT00000010063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKVQSMNLFVQKRCLCLAFLLQLLGQVSATQRCPSPCPRQCPETPPTCAPGVRAVLDGC
SCCLVCARQRGESCSELKPCDQSSGLYCDRSADPSNQTGICMVLEGDNCVFDGVIYRSGE
KFEPNCQYHCTCRDGQIGCVPRCQLDVLLPGPDCPAPRKVAVPGECCEKWTCGPNEKGAL
GGLALPAYRPEATVGVEVSDSSINCIEQTTEWSACSKSCGMGLSTRVTNRNRQCEMVKQS
RLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCC
TPHNTKTIQVEFQCSPGQIIKKPVMVIGTCTCHTNCPQNNEAFLQELELKTSRGEM
Download sequence
Identical sequences ENSSTOP00000009026 XP_005316265.1.77405 ENSSTOP00000009026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]