SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000009037 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000009037
Domain Number 1 Region: 567-828
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.72e-93
Family Eukaryotic proteases 0.0000000228
Further Details:      
 
Domain Number 2 Region: 314-420
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-29
Family Spermadhesin, CUB domain 0.00071
Further Details:      
 
Domain Number 3 Region: 201-306
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-19
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 4 Region: 62-147
Classification Level Classification E-value
Superfamily SEA domain 0.000000000000929
Family SEA domain 0.011
Further Details:      
 
Domain Number 5 Region: 499-533
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 427-462
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000012
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 7 Region: 462-499
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 8 Region: 539-578
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000028
Family LDL receptor-like module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000009037   Gene: ENSSTOG00000010074   Transcript: ENSSTOT00000010075
Sequence length 829
Comment pep:known_by_projection scaffold:spetri2:JH393382.1:2138370:2161811:-1 gene:ENSSTOG00000010074 transcript:ENSSTOT00000010075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNMKGFEEGVEFLPVNNAKKVEKRGPRRWVVLVALLIGFLLLSLVVGLLVWHFQYRNARI
QKVFNGYLRITNENFVDAYENSNSTEFKSLASKVKEALKLLYSEVPILGPYHKKSVVTAF
SEGSVIAYYWSEFSIPQHLEEETERIMAQEQVISLPPRSRALQSFVLTSVVAFPSDPRTI
QRPRDNKCSFALHARGKELTRFTTPGFPNSPYPARARCQWALRGDADSVLSLTFHSFDVA
PCDMQGSDLVMVYDTLSPVEPHAVVRLCGTYPPSYNLTFLSSQNVLLVTLITSTERRHPG
FEATFFQLQKMSRCGGSLRESQGTFSSPYYPGHYPPNIDCTWNIEVPKNKNVKVRFKIFY
LVEPNLPLGTCPKDYVEINGEKYCGERSQFVVSSNSNKITVRFHSDQSYTDTGFLAEYLS
YDSSDPCPGMFTCKTGRCIQRNLRCDGWADCTDYSDELHCACNATHQFTCKNNFCKPLFW
VCDSVNDCGDNSDEEGCSCSAGNFQCANGKCLPQSQRCNGKDNCGDGSDEISCDSASVVT
CTEHTYRCHNGLCLSKGSPECDGKKDCSDGSDEKDCDCGLRSFSKQARVVGGTNADQGEW
PWQVSLHSQGQGHVCGASLISPNWLVSAAHCFMDDRDFRYSDPTLWTAFLGLHDQSKRSD
SGVQEHQLKRIITHPSFNDFTFDYDIALLELKKPAEYSSVVRPICLPDTSHVFPVGKAIW
VTGWGHTQEGGSGALILQKGEIRIINQTTCEGLMPQQITPRMMCVGFLSGGVDACQGDSG
GPLSSVEEDGRIFQAGVVSWGEGCAQRNKPGVYTRLPVFRDWIKEQTGV
Download sequence
Identical sequences ENSSTOP00000009037 ENSSTOP00000009037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]