SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000009077 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSTOP00000009077
Domain Number - Region: 82-121
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 0.023
Family Zn-finger domain of Sec23/24 0.013
Further Details:      
 
Domain Number - Region: 224-271
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0497
Family Multidrug resistance efflux transporter EmrE 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000009077   Gene: ENSSTOG00000010120   Transcript: ENSSTOT00000010118
Sequence length 284
Comment pep:known_by_projection scaffold:spetri2:JH393687.1:670098:672895:-1 gene:ENSSTOG00000010120 transcript:ENSSTOT00000010118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAADGERSPLLSEPIDGGAGGNGLVGPGGSGAGPGGGLTPSAPPYGAGKHAPPQAFPPFP
EGHPAVLPGEDPPPYSPLTSPDSGSAPMITCRVCQSLINVEGKMHQHVVKCGVCNEATPI
KNAPPGKKYVRCPCNCLLICKVTSQRIACPRPYCKRIINLGPVHPGPSSPDPQPMGVRVI
CGHCKNTFLWTEFTDRTLARCPHCRKVSSIGRRYPRKRCICCFLLGLLLAVTATGLAFGT
WKHARRYGGIYAAWAFVILLAVLCLGRALYWACMKVSHPVQNFS
Download sequence
Identical sequences ENSSTOP00000009077 XP_005341463.1.77405 XP_015336354.1.40921 ENSSTOP00000009077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]