SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000009180 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000009180
Domain Number 1 Region: 13-213
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.56e-24
Family Protein-L-isoaspartyl O-methyltransferase 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000009180
Domain Number - Region: 340-358
Classification Level Classification E-value
Superfamily SOCS box-like 0.0876
Family SOCS box-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000009180   Gene: ENSSTOG00000010236   Transcript: ENSSTOT00000010232
Sequence length 360
Comment pep:known_by_projection scaffold:spetri2:JH393324.1:11378014:11394067:1 gene:ENSSTOG00000010236 transcript:ENSSTOT00000010232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGAVSAGEDNDELIDNLKEAQYIRTELVEQAFRAIDRADYYLEEFKENAYKDLAWKHGN
IHLSAPCIYSEVMEALDLQPGLSFLNLGSGTGYLSSMVGLILGPFGVNHGVELHSDVIEY
AKQKLDFFIRTSDSFDKFDFCEPSFVTGNCLEISPDCSQYDRVYCGAGVQKEHEEYMKSL
LKVGGILVMPLEEKLTKITRIGPSAWETKKILAVSFAPLVQPCHSESGKSRLVQLPPLAV
RSLQDLARIAIRGTIKKVIHQEAASRSGSGLKNTPRCKRRRVRRRRMETIVFLDKEVFAS
RISNPSDDNSCEDLEEERREEEKTLPETKPDPPVNFLRQKVLSLPLPDPLKYYLLYYREK
Download sequence
Identical sequences I3MF33
ENSSTOP00000009180 ENSSTOP00000009180 XP_013214068.1.77405 XP_013214069.1.77405 XP_015333380.1.40921 XP_015333388.1.40921 XP_015333399.1.40921 XP_021582130.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]