SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000009206 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSTOP00000009206
Domain Number - Region: 78-113
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0319
Family Fibronectin type III 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000009206   Gene: ENSSTOG00000010261   Transcript: ENSSTOT00000010259
Sequence length 263
Comment pep:novel scaffold:spetri2:JH393388.1:2886994:2889557:-1 gene:ENSSTOG00000010261 transcript:ENSSTOT00000010259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIFRPWRLRCPALHLPSFSTFSLKWSLPSLYTDEDMCKSVTTGEWKKVFYEKMEEAKPA
DSWDLIIDPNLKHNVLAPGWKQYLELHASGRFHCSWCWHTWQSPHVVILFHMYLDRAQRA
GSVRMRVFKQLCYECGTARLDESSMLEENIESLVDNLITSLREQCYGERGGQYRIHVASR
QDHRRHRGEFCEACQEGIVHWKPSQKLLEEEATTYTFSRAPSPTKPQAEEGSGCNFCSIP
WCLFWATVLLLIIYLQFSFRSSF
Download sequence
Identical sequences I3MF54
XP_005331048.1.77405 ENSSTOP00000009206 ENSSTOP00000009206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]