SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000009388 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000009388
Domain Number 1 Region: 22-143
Classification Level Classification E-value
Superfamily Immunoglobulin 1.22e-16
Family V set domains (antibody variable domain-like) 0.0051
Further Details:      
 
Domain Number 2 Region: 136-232
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000169
Family I set domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000009388   Gene: ENSSTOG00000010462   Transcript: ENSSTOT00000010461
Sequence length 318
Comment pep:novel scaffold:spetri2:JH393291.1:18866212:18880391:1 gene:ENSSTOG00000010462 transcript:ENSSTOT00000010461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IGRHIPLLSPHTSVWVTVNAISVETPQEILRAARGKSATLPCTYHTSVPDRDGLVQWDKL
LRTHSEKVVIWSFKTQSYIFGELYENRVNISSHVGQSDASITIDQLTMEDNGTYECSVSL
LSDMVGTSKSRVRLMVLVPPSKPDCGIEGETVIGNNIQLTCQSAEGSPAPQYSWKSYNPQ
NQERPLVPPVSGQTVFLKNISTDTSGYYVCTSSNDVGTAFCNITVAVRPPSMNVALYAGI
AGGVVAALIILGIIIYCCCFREKDDKEVDKEDTRPNRAAYQEPPEQLRELSRGREEEDDY
RHQDQRSSGRESPDRAGQ
Download sequence
Identical sequences ENSSTOP00000009388 ENSSTOP00000009388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]