SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000009493 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000009493
Domain Number 1 Region: 11-220
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 6.11e-59
Family Proteasome subunits 0.00000000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000009493   Gene: ENSSTOG00000010581   Transcript: ENSSTOT00000010576
Sequence length 221
Comment pep:known_by_projection scaffold:spetri2:JH393908.1:67408:79781:1 gene:ENSSTOG00000010581 transcript:ENSSTOT00000010576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAAGPWRLRFSPYAFNGGTVLAIAGEDFSIVASDTRLSEGFSIHTRDSPKCYKLTDKTVI
GCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGG
LDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAM
RLVKDVFISAAERDVYTGDALRICIVTKEGIREETVPLRKD
Download sequence
Identical sequences ENSSTOP00000009493 ENSSTOP00000009493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]