SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000009562 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000009562
Domain Number 1 Region: 1-142
Classification Level Classification E-value
Superfamily Globin-like 2.32e-48
Family Globins 0.000000378
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000009562   Gene: ENSSTOG00000010650   Transcript: ENSSTOT00000010651
Sequence length 142
Comment pep:novel scaffold:spetri2:JH393311.1:729234:729925:-1 gene:ENSSTOG00000010650 transcript:ENSSTOT00000010651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLSPADKNNVKACWEKIGGHGAAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVQGHG
KKVADALANAAAHVDDLPGALSTLSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPAEFTP
AVHASLDKFLASVSTVLTSKYR
Download sequence
Identical sequences A0A287D1R9
ENSSTOP00000009562 ENSSTOP00000009562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]