SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000009828 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000009828
Domain Number 1 Region: 538-570,651-725
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000216
Family Anti-sigma factor antagonist SpoIIaa 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000009828   Gene: ENSSTOG00000010945   Transcript: ENSSTOT00000010954
Sequence length 748
Comment pep:known_by_projection scaffold:spetri2:JH393289.1:16435779:16481329:-1 gene:ENSSTOG00000010945 transcript:ENSSTOT00000010954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPGSRSDPPQLPEYSCSYVVSRPVYNELAFQQQHERRLQERRTLRESLAKSCSCSRKR
AFGVLKSLLPILDWLPKYRIKEWLLSDIISGVSTGLVGTLQGMAYALLAAVPIGYGLYSA
FFPILTYFIFGTSRHISVGPFPVVSLMVGSVVLSMAPDEQFLMSSNNGSTLNTTMLDTTA
RDTARVMIASTLTLLVGIIQLVFGGLQIGFIVRYLADPLVGGFTTAAAFQVLVSQLKIVL
NVSTQNYNGVLSIIYTLVEIFQNIGDTNLADFIAGLLTIVICMAVKELNDRFKHKIPVPI
PIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFLPPALPPVNLFSKMLTASFSIAVVA
YAIAVSVGKVYAIKHDYTIDGNQEFIAFGISNIFSGFFSCFVATTALSRTAVQESTGGKT
QIAGIISAGIVMIAIVALGKLLEPLQKSVLAAVVIANLKGMFMQVCDVPRLWRQNKTDAV
IWVFTCIMSIILGLDLGLLAGLLFGLLTVVLRVQFPSWNGLGSIPSTDIYKSIKHYKNVE
ELEGVKILRFSSPIFYGNVDGFKKCIKSTVGFDAIRVYNKRLKALRRIQKLIKKGQLRAT
KNGIVSDVGSSNNAFEPDEDIEDPEELDIPTKEIEVQVDWNSELPVKVNVPKVPIHSLVL
DCGAISFLDVVGVRSLRLIVKEFQRIDVNVYFASLEDHVIEKMEQCGFFDDNIRKDTFFL
TVHDAIIYIQNQVKSQDGQDSILETVSI
Download sequence
Identical sequences I3MGF0
ENSSTOP00000009828 XP_005319502.1.77405 ENSSTOP00000009828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]