SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000009847 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000009847
Domain Number 1 Region: 523-554,636-710
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000628
Family Anti-sigma factor antagonist SpoIIaa 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000009847   Gene: ENSSTOG00000010967   Transcript: ENSSTOT00000010976
Sequence length 759
Comment pep:known_by_projection scaffold:spetri2:JH393289.1:16350773:16377304:1 gene:ENSSTOG00000010967 transcript:ENSSTOT00000010976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEPIGNQYVVARPVYSANTFGEEHKKKHRHHKTFLDHLKLCCSCSTQKAKRIALSFFPI
ASWLPSYRIKEWLLSDIVSGISTGLVAVLQGLAFALLVTIPPRYGLYAAFFPVIVYFFLG
TSKHISVGPFPVLSMMVGAVVTNVVSDASTTMESSNSTENNESILEQKKLLVATTVTVLS
GIIQLVLGVLRIGFVVIYLSESLISAFTTAAAVHVLVSQLKFMLQLSVPAHTDPFSIFKV
LESVFTQIEKTNIADLVTSLIILFIVFVFKEINQRYKSKLPVPIPIELIVTVIATGVSYG
FDFEHRFNVSVVGQMDTGFEPPITPDVQIFQDTIGDSFGIAIVGFAVAFSVASVYSLKYD
YPIDGNQELIALGLSNIFTGSFRGFAGSTALSRSGVQESTGGKTQVAGLLSAIIVLIVIV
AIAFLLAPLQKSVLAALALGNLKGMLMQFAEIGRLWRKDKYDCLVWIMTFIFAIVLGLGL
GLAASVAFQLLTIVFRTQFPKCSTLANIGRSNIYKDKKDYSDMYEPEGVKIFRCPSPIYF
ANIGFFKQKLIDAVGFTPLRILRKRNKALKKIRKLQKRGLLQVTPKGFICTADGFKDSDE
ELDNNQMEELDQPINTTDLPFQIDWNADLPLNIMVPKISLHSLILDFSAVSFLDVSSMRG
LKTILQDFIRINVDVYIVGTDDDFIEKLARCEFFDDEVKDSIFFLTIHDAVLHILMKKDY
STSKFNFNQKKEMKSDFTINTNGGLRYREYQQVPLETKF
Download sequence
Identical sequences ENSSTOP00000009847 ENSSTOP00000009847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]