SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000009916 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSTOP00000009916
Domain Number - Region: 2-144
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000667
Family SMI1/KNR4-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000009916   Gene: ENSSTOG00000011053   Transcript: ENSSTOT00000011054
Sequence length 246
Comment pep:known_by_projection scaffold:spetri2:JH393327.1:8590875:8607655:1 gene:ENSSTOG00000011053 transcript:ENSSTOT00000011054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KNNCVMPEDLKNFYLMTNGFHMTWSVKLDEHIIPLGSMTINSISKLTQLNQSSMYSLPNA
PTLADLEDDTYEASEDQPEKPHFDSRSVIFELDSCSGNGKVCLVYKSGKPASAQDTEIWF
LDRALYWHFLTDTFTAYYRLLITHLGLPQWQYAFTRYGISPQAKQWFSMYKPITYNTDLL
TEETDSFVNKLDPSKVFKSKNKPLIPKKKAAVQPAGGQKGPSGPTTSKPSSGPGNPVRKL
LHFEHL
Download sequence
Identical sequences ENSSTOP00000009916 ENSSTOP00000009916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]