SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000010629 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000010629
Domain Number 1 Region: 61-140
Classification Level Classification E-value
Superfamily Ribosomal protein S18 8.89e-25
Family Ribosomal protein S18 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000010629   Gene: ENSSTOG00000011853   Transcript: ENSSTOT00000011851
Sequence length 195
Comment pep:known_by_projection scaffold:spetri2:JH393647.1:295016:299755:1 gene:ENSSTOG00000011853 transcript:ENSSTOT00000011851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVCTSAPPEKDSLPSVPISPYENEPWKYLDSEEYQNRYGNRPVWADYRRNHKGGIPPQQT
RKTCIRKNKIAGNPCPICRDHNLYVDFRNVKLLEQFVCAHTGIIFHAPYTGVCMKQHKKL
TQAIQKARDHGLLSYHIPQVEPRDLDFSTSHGAVTSTPPAPTLVSGDPWYPWYTWKQPPE
RELSRLRRLYQGNLL
Download sequence
Identical sequences ENSSTOP00000010629 ENSSTOP00000010629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]