SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000010661 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000010661
Domain Number 1 Region: 49-276,313-338
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.34e-41
Family FAD-linked reductases, N-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000010661   Gene: ENSSTOG00000011889   Transcript: ENSSTOT00000011887
Sequence length 463
Comment pep:known_by_projection scaffold:spetri2:JH393305.1:15238770:15276640:1 gene:ENSSTOG00000011889 transcript:ENSSTOT00000011887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPVLRYLGGACGRARGGFPGSFSGVCGPASGRPWPLCGAVRSASSSSFDIVIVGGGIVG
LASARALILRHPALSIGVLEKEKDLATHQTGHNSGVIHSGIYYKPESLKAKLCVQGAGLI
YEYCNKKGISYKQCGKLIVAVEQEEIPRLRALYERGLQNGVQGLRLIQQEDIKKKEPYCR
GLMAIDCPYTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKDIEMAGESPPRSIDGMKYPI
MVKNTKGEEIQCQYVVTCAGLHSDRISELSGCNPDPQIVPFRGDYLLLKPEKCYLVKGNI
YPVPDSRFPFLGVHFTPRMDGNIWLGPNAVLAFKREGYRPFDFSARDAKDLIANSGLIKL
ISQNLSYGVSEMYKACFLSATVKHLQKFIPEITISDILRGPAGVRAQALDRDGNLVDDFV
FDGGVGDIGSRILHVRNAPSPAATSSLAISGMIADEVQQRFEL
Download sequence
Identical sequences I3MI58
ENSSTOP00000010661 ENSSTOP00000010661 XP_013212985.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]