SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000010720 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000010720
Domain Number 1 Region: 61-167
Classification Level Classification E-value
Superfamily Lysozyme-like 9.19e-40
Family C-type lysozyme 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000010720   Gene: ENSSTOG00000011952   Transcript: ENSSTOT00000011950
Sequence length 167
Comment pep:known_by_projection scaffold:spetri2:JH394722.1:18181:19790:1 gene:ENSSTOG00000011952 transcript:ENSSTOT00000011950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLMNRLSSQSSALTPCGGGYISATGMKARSWVPRRRLSPPRVTWLALVSLLSGLLTSSQA
KVFSRCELAKELHRMGLDGFRGYELADWVCLAYFTSGFNTAAVDHEADGSTNNGLFQINS
RKWCRNLSLDSLNLCKMYCSDLLTPDLKNAVVCVMKIVSGPKGLGYW
Download sequence
Identical sequences I3MI98
ENSSTOP00000010720 ENSSTOP00000010720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]