SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000010761 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000010761
Domain Number 1 Region: 146-468
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.74e-123
Family Transglutaminase core 0.0000000000293
Further Details:      
 
Domain Number 2 Region: 5-144
Classification Level Classification E-value
Superfamily E set domains 9.1e-42
Family Transglutaminase N-terminal domain 0.00000106
Further Details:      
 
Domain Number 3 Region: 479-594
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 7.85e-33
Family Transglutaminase, two C-terminal domains 0.00000249
Further Details:      
 
Domain Number 4 Region: 595-694
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.14e-28
Family Transglutaminase, two C-terminal domains 0.00000867
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000010761   Gene: ENSSTOG00000011992   Transcript: ENSSTOT00000011994
Sequence length 696
Comment pep:known_by_projection scaffold:spetri2:JH393371.1:3181951:3205936:1 gene:ENSSTOG00000011992 transcript:ENSSTOT00000011994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSVDLVLERCDLELEANGRDHHTADLCQDRLVLRRGQGFWLTLHFEGRGYEASVDTLTFS
AVTGPNPSEEAGTKARFQLADTLEQGTWTAFVADQQDTTLSLQVSTPANAPIGLYRLSME
ASTGYQGSSFVLGHFTLLFNAWCPADAVYLDSEEERQEYVLTQQGLIYQGSAKFIKSVPW
NFGQFEDGILDICLMLLDINPKFLQDANQDCAGRSSPVYVGRVVSRMVNCNDDQGVLLGR
WDNNYGDGVSPMFWIGSVDILRRWKDHGCQNVKYGQCWVFAAVACTVLRCLGVPSRVVTN
YNSAHDQNSNLVIEYFRNELGELESDRSEMIWNFHCWVESWMTRPDLEAGYEGWQALDPT
PQEKSEASSPQTGTYCCGPVPVRAIKEGDLNTKYDAPFVFAEVNADVVDWIRQEDGSLHK
SVNNSLVVGLKISTKGVGRDDREDITHTYKYPEGSPEEREAFTKANHLNKLAEKEAAKET
EVAMRIRVSQSMNMGTDFDVFAYITNNTPENRECRLLLCARTVSYNGVLGPECGSKSLPD
LTLEPFSEKSIPLPILYEQYRDFLTESNLIKVQGLLIEPAANSYVLAQRDLYLENPEIKI
RILGEPKQNRKLVAEVSLRNPLTVPLLDCIFTVEGAGLTKEQLSVEVPDPVEPGEVAKAR
VNLLPIDIGLHKLVVNFQCDRLKAVKGYRNVIIGGP
Download sequence
Identical sequences ENSSTOP00000010761 ENSSTOP00000010761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]