SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000010779 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000010779
Domain Number 1 Region: 24-198
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 6.32e-61
Family Crystallins/Ca-binding development proteins 0.0000358
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000010779   Gene: ENSSTOG00000012017   Transcript: ENSSTOT00000012013
Sequence length 211
Comment pep:known_by_projection scaffold:spetri2:JH393467.1:300931:305525:1 gene:ENSSTOG00000012017 transcript:ENSSTOT00000012013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQHGAPEQAAAGKSHGGLGGGYKVTVYELENFQGKRCELSTECPNLTDSLLEKVGSIQ
VESGPWLAFECRSFRGEQFVLEKGDYPRWDAWSNSRHSDSLLSLRPLEIDGPDHKLHLFE
NPAFSGRKMEIVDDDVPSLWAHGFQDRVASIRAINGTWVGYEFPGYRGRQYVLERGEYRH
WNEWDANQPQLQSVRRIRDQKWHKRGCFLSS
Download sequence
Identical sequences I3MIE4
ENSSTOP00000010779 ENSSTOP00000010779 XP_021589425.1.77405 XP_021589426.1.77405 XP_021589427.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]