SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000010862 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000010862
Domain Number 1 Region: 50-160
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 4.19e-38
Family Frizzled cysteine-rich domain 0.0000587
Further Details:      
 
Domain Number 2 Region: 177-305
Classification Level Classification E-value
Superfamily TIMP-like 3.92e-23
Family Tissue inhibitor of metalloproteinases, TIMP 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000010862   Gene: ENSSTOG00000012113   Transcript: ENSSTOT00000012113
Sequence length 315
Comment pep:known_by_projection scaffold:spetri2:JH393446.1:1968538:1973225:1 gene:ENSSTOG00000012113 transcript:ENSSTOT00000012113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAAAGGARAAALALLLGALHGAPARGEEYDYYGWQAEPLHGRSYSKPPQCLDIPADLPL
CHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRPIY
PCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPATAPPVTKTCA
QCEIEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRKLIGAQKKKKLLKPGPLKRKDTKK
LVLHMKNGAGCPCPQLDSLAGSFLVMGRKVDGQLLLMAVYRWDKKNKEMKFAVKFMFSYP
CSLYYPFFYGAAEPH
Download sequence
Identical sequences A0A287D480
ENSSTOP00000010862 ENSSTOP00000010862 XP_005335308.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]